General Information

  • ID:  hor006546
  • Uniprot ID:  P51921
  • Protein name:  Progonadoliberin-3
  • Gene name:  gnrh3
  • Organism:  Pagrus major (Red sea bream) (Chrysophrys major)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Pagrus (genus), Sparidae (family), Spariformes (order), Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSYGWLPGGKRSVGELEATIRMMGTGGVVSLPEEASAQTQERLRPYNVIKDDSSHFDRKKRFPNK
  • Length:  67
  • Propeptide:  MEASSRVTVQVLLLALVVQVTLSQHWSYGWLPGGKRSVGELEATIRMMGTGGVVSLPEEASAQTQERLRPYNVIKDDSSHFDRKKRFPNK
  • Signal peptide:  MEASSRVTVQVLLLALVVQVTLS
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P51921-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006546_AF2.pdbhor006546_ESM.pdb

Physical Information

Mass: 880897 Formula: C335H525N101O100S2
Absent amino acids: C Common amino acids: GRS
pI: 10.16 Basic residues: 13
Polar residues: 20 Hydrophobic residues: 17
Hydrophobicity: -94.18 Boman Index: -17208
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 56.72
Instability Index: 5595.37 Extinction Coefficient cystines: 13980
Absorbance 280nm: 211.82

Literature

  • PubMed ID:  7851723
  • Title:  Molecular cloning of a cDNA encoding the prepro-salmon gonadotropin-releasing hormone of the red seabream.